General Information

  • ID:  hor001488
  • Uniprot ID:  Q9TUX7
  • Protein name:  Neuropeptide SF
  • Gene name:  NPFF
  • Organism:  Bos taurus (Bovine)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0060079 excitatory postsynaptic potential
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030425 dendrite; GO:0043204 perikaryon; GO:0043679 axon terminus; GO:0098794 postsynapse

Sequence Information

  • Sequence:  SPAFLFQPQRF
  • Length:  11
  • Propeptide:  MDARQAAALLLVLLLVTDWSHAEGPGGRDGGDQIFMEEDSGAHPAQDAQTPRSLLRSLLQAMQRPGRSPAFLFQPQRFGRNTRGSWSNKRLSPRAGEGLSSPFWSLAAPQRFGKK
  • Signal peptide:  MDARQAAALLLVLLLVTDWSHA
  • Modification:  T11 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPFFR2, NPFFR1
  • Target Unid:  F1MXG2, F1N1Y7
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9TUX7-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001488_AF2.pdbhor001488_ESM.pdb

Physical Information

Mass: 151608 Formula: C65H92N16O15
Absent amino acids: CDEGHIKMNTVWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: -13.64 Boman Index: -1373
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 44.55
Instability Index: 10156.36 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10220558
  • Title:  Gene for pain modulatory neuropeptide NPFF: induction in spinal cord by noxious stimuli.